PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0003s1010.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 673aa    MW: 74844.6 Da    PI: 6.4146
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0003s1010.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3681.4e-21116206197
                             EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                             f+k+lt sd++++g +++ +k+a+e+  +   + +l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + 
  SapurV1A.0003s1010.7.p 116 FCKILTASDTSTHGGFSVLRKHATECL-P---PLELAARDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RG 196
                             99************************4.4...247************************************************..34 PP

                             SEE..EEEEE CS
                      B3  88 sefelvvkvf 97 
                             +++el+v+v+
  SapurV1A.0003s1010.7.p 197 DNGELRVGVR 206
                             8888999986 PP

2Auxin_resp93.92.6e-31233312183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+ t++ F v+Y+Pr+   ++++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vg+ d++p +W++S WrsLk
  SapurV1A.0003s1010.7.p 233 ASHAVLTQTLFVVYYKPRT--NQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTGTIVGIGDISP-EWSGSIWRSLK 312
                             68999*************6..99**********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-35107236IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-34110222IPR015300DNA-binding pseudobarrel domain
CDDcd100171.19E-19114207No hitNo description
SMARTSM010191.8E-20116209IPR003340B3 DNA binding domain
PfamPF023629.5E-20116206IPR003340B3 DNA binding domain
PROSITE profilePS5086310.884116209IPR003340B3 DNA binding domain
PfamPF065071.6E-29233312IPR010525Auxin response factor
PfamPF023096.2E-7536593IPR033389AUX/IAA domain
SuperFamilySSF542772.11E-11552633No hitNo description
PROSITE profilePS5174525.528557638IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MAHVERGCDD LYTELWKACA GPLVDVPKAG ERVFYFPQGH MEQLEASTNQ ELNQQIPRFN  60
LPPKILCRVI NIQLLAEQDT DEVYAQIALH PEADQTEPTS PDPCPPEPEK QTIHSFCKIL  120
TASDTSTHGG FSVLRKHATE CLPPLELAAR DLHGFEWRFK HIFRGQPRRH LLTTGWSTFV  180
TSKRLVAGDA FVFLRGDNGE LRVGVRCLAR QQSSIPSSVI SSQSMHLGVL ATASHAVLTQ  240
TLFVVYYKPR TNQYIIGLNK YLEAVKNGFS VGMRFKMRFE GEDSPERRFT GTIVGIGDIS  300
PEWSGSIWRS LKIQWDEPAT IQRPERVSPW DIEPFAAPAS PNLTQQVVKN KRPRPTDIPT  360
SAASSFWYHG STQSHELAQL GCSTEVQSSE SHVWSMRQKE IDSNLLNNSS SCNTRARPEG  420
MWPSSPHMNV SLNFFPDSAG DNDFATTRSI ISGFSSPMSS RQSNCLISEQ VEKGRKYENS  480
AGCRLFGIDL TSNSGSSAPP EKEPAYPITK VLVPAASEAE RAQTMDVSMY SKEQKQVLSE  540
ALLKESRSKQ GSATSTRTCT KVQMQGIAVG RALDLTALKG YMDLINELEK MFEIEGELST  600
PKKWAVVFTD DEGDMMLLGD DPWLEFCKMV KKIFIYSSDE VKKTGTRCKL SASSFEGEGT  660
VVSMDSEHRS DA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-167933517355Auxin response factor 1
4ldw_A1e-167933517355Auxin response factor 1
4ldw_B1e-167933517355Auxin response factor 1
4ldx_A1e-167933517355Auxin response factor 1
4ldx_B1e-167933517355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1350354KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1646980.0KT164698.1 Populus tomentosa clone Potom.002G07206 auxin response factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386630.10.0hypothetical protein POPTR_0002s17350g
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLU5GT510.0U5GT51_POPTR; Auxin response factor
STRINGPOPTR_0002s17350.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9